PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_16900A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 334aa    MW: 35493 Da    PI: 6.3651
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_16900AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.51.5e-181057148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT+eEd+llv+++++ G g+W++ ++  g++R++k+c++rw +yl
  Oropetium_20150105_16900A 10 KGPWTPEEDKLLVEYIQKNGHGSWRRLPKLAGLNRCGKSCRLRWTNYL 57
                               79********************************************97 PP

2Myb_DNA-binding56.65.8e-1863108148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                rgr+T +E++l+++++  lG++ W++Ia +++ gRt++++k++w+++l
  Oropetium_20150105_16900A  63 RGRFTDDEEKLIIHLHSILGNK-WSSIATKLP-GRTDNEIKNYWNTHL 108
                                89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.15557IPR017930Myb domain
SuperFamilySSF466894.03E-317104IPR009057Homeodomain-like
SMARTSM007173.3E-15959IPR001005SANT/Myb domain
PfamPF002491.8E-171057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-241164IPR009057Homeodomain-like
CDDcd001674.01E-121257No hitNo description
PROSITE profilePS5129427.47258112IPR017930Myb domain
SMARTSM007171.5E-1662110IPR001005SANT/Myb domain
PfamPF002494.3E-1663108IPR001005SANT/Myb domain
CDDcd001677.80E-1365108No hitNo description
Gene3DG3DSA:1.10.10.602.9E-2665112IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MAANEAGVKK GPWTPEEDKL LVEYIQKNGH GSWRRLPKLA GLNRCGKSCR LRWTNYLRPD  60
IKRGRFTDDE EKLIIHLHSI LGNKWSSIAT KLPGRTDNEI KNYWNTHLRK KLLNMGIDPV  120
THRPRTDLNL LAGLPNLLAA ANLAGNTNWD INALKLQADA AKFQLLQGLV RAIASAATPS  180
VDLRALLAAS SSGGLSQTAI SVDQGSSRSL QYDGLLNLPA LTSVPTVSAG MSSFSGLLNG  240
FGGVAGDGLS STTELGQSGA SGSSMTAAKA PPLVAAAEEC NAADGSGGAT PCEETPASSP  300
FEGLENLNLD DLSNDDSWKD LLDQMSWFNP NEM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-30101127108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7276651e-131KJ727665.1 Zea mays clone pUT5592 MYB transcription factor (MYB148) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964317.11e-172PREDICTED: transcription factor MYB39-like
SwissprotQ8GWP04e-71MYB39_ARATH; Transcription factor MYB39
TrEMBLK3XXY21e-172K3XXY2_SETIT; Uncharacterized protein
STRINGSi006790m1e-172(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55293158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10280.15e-75myb domain protein 92